HORDB

ID: hor002017
Uniprot ID: P37042
Protein name: Progonadoliberin-1
Gene name: GNRH1
Organism: Gallus gallus (Chicken)
Family: GnRH family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0005515 protein binding; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction; GO:0032275 luteinizing hormone secretion; GO:0033686 positive regulation of luteinizing hormone secretion; GO:0043279 response to alkaloid; GO:0046885 regulation of hormone biosynthetic process; GO:1904014 response to serotonin; GO:2000843 regulation of testosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSYGLQPGGKRNAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
Length: 69
Propeptide: MEKSRKILVGVLLFTASVAICLAQHWSYGLQPGGKRNAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
Signal peptide: MEKSRKILVGVLLFTASVAICLA
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002017_AF2.pdb

hor002017_ESM.pdb

Mass:	897366	Formula:	C332H524N98O111S3
Absent amino acids:		Common amino acids:	E
pI:	4.79	Basic residues:	10
Polar residues:	20	Hydrophobic residues:	17
Hydrophobicity:	-98.55	Boman Index:	-17046
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	62.32
Instability Index:	5744.2	Extinction Coefficient cystines:	8480
Absorbance 280nm:	124.71